(data stored in ACNUC7421 zone)

EMBL: CP001622.PE61

CP001622.PE61        Location/Qualifiers
FT   CDS             60715..61329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0062"
FT                   /product="OstA family protein"
FT                   /note="PFAM: OstA family protein; KEGG:
FT                   rec:RHECIAT_CH0000444 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54373"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYE9"
FT                   /inference="protein motif:PFAM:PF03968"
FT                   /protein_id="ACS54373.1"
FT                   /translation="MAFIAGAFALILTASGAGAQQATATMPGMKLSNDQPIQIESDKLE
FT                   IHDQEHTALFTGNVKVVQGATTMQSGKMTVYYKDKAAKPATDGTQPAAQPAAQPQQSAS
FT                   LASGSADIDKILVTDKVFLTSGTQTATADDGNFDMASQTFILTADEGKKVILSDGPNVF
FT                   TGCKLTVHMQTGQAELESCGGRVQIQLDPKSKPNTPQQKQN"
     MAFIAGAFAL ILTASGAGAQ QATATMPGMK LSNDQPIQIE SDKLEIHDQE HTALFTGNVK        60
     VVQGATTMQS GKMTVYYKDK AAKPATDGTQ PAAQPAAQPQ QSASLASGSA DIDKILVTDK       120
     VFLTSGTQTA TADDGNFDMA SQTFILTADE GKKVILSDGP NVFTGCKLTV HMQTGQAELE       180
     SCGGRVQIQL DPKSKPNTPQ QKQN                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page