(data stored in ACNUC7421 zone)

EMBL: CP001622.PE62

CP001622.PE62        Location/Qualifiers
FT   CDS             61370..62146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0063"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000445 probable amino acid ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54374"
FT                   /db_xref="GOA:C6AYF0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54374.1"
FT                   /translation="MFGKPGPQAAGAADKSRYQGTLIARGLTKTYATRRVVNGVSLVVR
FT                   RGEAVGLLGPNGAGKTTCFYMITGLVPVDEGTIEIDGNDVTTMPMYRRSRLGVGYLPQE
FT                   ASIFRGLTVEENIRAVLEVHVKDKAEREQKLNELLEEFHIQKLRKSAAVALSGGERRRL
FT                   EIARALATDPTFMLLDEPFAGVDPISVADIQNLVHHLTARGIGVLITDHNVRETLGLID
FT                   RAYIIHAGEVLTHGRANDIVNNPEVRRLYLGDNFSL"
     MFGKPGPQAA GAADKSRYQG TLIARGLTKT YATRRVVNGV SLVVRRGEAV GLLGPNGAGK        60
     TTCFYMITGL VPVDEGTIEI DGNDVTTMPM YRRSRLGVGY LPQEASIFRG LTVEENIRAV       120
     LEVHVKDKAE REQKLNELLE EFHIQKLRKS AAVALSGGER RRLEIARALA TDPTFMLLDE       180
     PFAGVDPISV ADIQNLVHHL TARGIGVLIT DHNVRETLGL IDRAYIIHAG EVLTHGRAND       240
     IVNNPEVRRL YLGDNFSL                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page