(data stored in ACNUC7421 zone)

EMBL: CP001622.PE63

CP001622.PE63        Location/Qualifiers
FT   CDS             62320..63879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0064"
FT                   /product="RNA polymerase, sigma 54 subunit, RpoN"
FT                   /note="TIGRFAM: RNA polymerase sigma-54 factor, RpoN; PFAM:
FT                   sigma-54 factor core-binding region; sigma-54 factor;
FT                   sigma-54 DNA-binding domain protein; KEGG: ret:RHE_CH00404
FT                   RNA polymerase factor sigma-54"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54375"
FT                   /db_xref="GOA:C6AYF1"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF1"
FT                   /inference="protein motif:TFAM:TIGR02395"
FT                   /protein_id="ACS54375.1"
FT                   /translation="MALSANLFLRQTQSLVMTPQLMQSIQLLQMTHFELNQFIALEVEK
FT                   NPLLEFPSNDGEAGGERGEAEDGEYAHQPEDAGSDDGYDNRTEALSSDWYDNGGSASTS
FT                   RLNDELDANYTNVFPDDGAPQRLDAPELVSQWKSMPGSGEGADYDLDDFVAGQVSLRDH
FT                   LAQQIPFVLPDMADRLIAQNFVDQLDDCGYLQADIVEAGERLGTSLAQAERVLATLQSL
FT                   DPPGVFARSLAECLAIQLKQKDRYDPAMQALVENLELLARRDFATLKRLCGVDEEDLLD
FT                   MLGEIRQLNPKPGSGFEAGISEAIMPDVVVRASSDGGWLVELNPDTLPRVLVNQSYFSR
FT                   VTKNGEDHAFLSDCLQTANWLTRSLDQRAKTIMKVASEIVRQQDAFLLHGVDYLRPLNL
FT                   KTVAEAIKMHESTVSRVTSNKYMLTPRGLFELKYFFTVSISAVAGGDSHSAEAVRHKIR
FT                   ALILQESPEAVLSDDDIVDMLKKGGVDLARRTVAKYREAMNIASSVQRRREKRALAKVA
FT                   GF"
     MALSANLFLR QTQSLVMTPQ LMQSIQLLQM THFELNQFIA LEVEKNPLLE FPSNDGEAGG        60
     ERGEAEDGEY AHQPEDAGSD DGYDNRTEAL SSDWYDNGGS ASTSRLNDEL DANYTNVFPD       120
     DGAPQRLDAP ELVSQWKSMP GSGEGADYDL DDFVAGQVSL RDHLAQQIPF VLPDMADRLI       180
     AQNFVDQLDD CGYLQADIVE AGERLGTSLA QAERVLATLQ SLDPPGVFAR SLAECLAIQL       240
     KQKDRYDPAM QALVENLELL ARRDFATLKR LCGVDEEDLL DMLGEIRQLN PKPGSGFEAG       300
     ISEAIMPDVV VRASSDGGWL VELNPDTLPR VLVNQSYFSR VTKNGEDHAF LSDCLQTANW       360
     LTRSLDQRAK TIMKVASEIV RQQDAFLLHG VDYLRPLNLK TVAEAIKMHE STVSRVTSNK       420
     YMLTPRGLFE LKYFFTVSIS AVAGGDSHSA EAVRHKIRAL ILQESPEAVL SDDDIVDMLK       480
     KGGVDLARRT VAKYREAMNI ASSVQRRREK RALAKVAGF                              519
//

If you have problems or comments...

PBIL Back to PBIL home page