(data stored in ACNUC7421 zone)

EMBL: CP001622.PE64

CP001622.PE64        Location/Qualifiers
FT   CDS             64007..64930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0065"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: rec:RHECIAT_CH0000447 putative
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54376"
FT                   /db_xref="GOA:C6AYF2"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF2"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACS54376.1"
FT                   /translation="MPTMMRQNSNLARELFLLLVLATLWGSSYSFIKIGVETIPPITLI
FT                   AARTLIAGGILLAVLRHRRVRLPRDLATWRRFFVQACLNSVVPFTLIAWAEQSVDAGLA
FT                   VILNSATPIFTFLLTVLITRHEQVTLRRLFGVMAGLAGICLVIGVEALGGLGESLMAQL
FT                   AIILATICYAGAAIFSKNFKGLDPAVPAAGSLISGAVVLLPMSLVVDRPWEIDPSPASM
FT                   LALLALSAFSTALAFVIYFRLVQTLGSVGTTAQAYLRVPIGVAIGIVFLGERLSPTAWI
FT                   GLVCVIAGVAAMTIPARRGTTQARNA"
     MPTMMRQNSN LARELFLLLV LATLWGSSYS FIKIGVETIP PITLIAARTL IAGGILLAVL        60
     RHRRVRLPRD LATWRRFFVQ ACLNSVVPFT LIAWAEQSVD AGLAVILNSA TPIFTFLLTV       120
     LITRHEQVTL RRLFGVMAGL AGICLVIGVE ALGGLGESLM AQLAIILATI CYAGAAIFSK       180
     NFKGLDPAVP AAGSLISGAV VLLPMSLVVD RPWEIDPSPA SMLALLALSA FSTALAFVIY       240
     FRLVQTLGSV GTTAQAYLRV PIGVAIGIVF LGERLSPTAW IGLVCVIAGV AAMTIPARRG       300
     TTQARNA                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page