(data stored in ACNUC7421 zone)

EMBL: CP001622.PE65

CP001622.PE65        Location/Qualifiers
FT   CDS             65223..65798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0066"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   rec:RHECIAT_CH0000448 probable sigma 54 modulation protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54377"
FT                   /db_xref="GOA:C6AYF3"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF3"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACS54377.1"
FT                   /translation="MSVRVSGKHMEIGESFRQRIEDQIGMAITKYFDGGYSGQVTVEKA
FT                   SSRYSADCKLHLDSGVVLHAAGEATDPQLAFDAASQRIEKRLRRYKRKLKDHHAGNHLN
FT                   GFAEVSYTVMDSVPDHDDEIADDFAPAIVAESTKQLKTMSVATAVMALDMTDEPLLLFR
FT                   SPGKEHLNIVYRRHDGNIGWIDSASIKG"
     MSVRVSGKHM EIGESFRQRI EDQIGMAITK YFDGGYSGQV TVEKASSRYS ADCKLHLDSG        60
     VVLHAAGEAT DPQLAFDAAS QRIEKRLRRY KRKLKDHHAG NHLNGFAEVS YTVMDSVPDH       120
     DDEIADDFAP AIVAESTKQL KTMSVATAVM ALDMTDEPLL LFRSPGKEHL NIVYRRHDGN       180
     IGWIDSASIK G                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page