(data stored in ACNUC7421 zone)

EMBL: CP001622.PE66

CP001622.PE66        Location/Qualifiers
FT   CDS             65869..66333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0067"
FT                   /product="PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /note="TIGRFAM: PTS IIA-like nitrogen-regulatory protein
FT                   PtsN; PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG:
FT                   rec:RHECIAT_CH0000449 protein-N(pi)-phosphohistidine-sugar
FT                   phosphotransferase protein (enzyme II of the
FT                   phosphotransferase system)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54378"
FT                   /db_xref="GOA:C6AYF4"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYF4"
FT                   /inference="protein motif:TFAM:TIGR01419"
FT                   /protein_id="ACS54378.1"
FT                   /translation="MALADLLHQDAIIPALRVNSKKQLLQELAARASRITGLSEREVFD
FT                   VILQRERLGSTGVGNGIAIPHGKLGNIHSIVGIFARLEQPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDLVAKLRATESASAIYAFLNEEQTSNAA"
     MALADLLHQD AIIPALRVNS KKQLLQELAA RASRITGLSE REVFDVILQR ERLGSTGVGN        60
     GIAIPHGKLG NIHSIVGIFA RLEQPVDFEA LDDQPVDLVF LLLAPEGAGA DHLKALSRIA       120
     RVLRDHDLVA KLRATESASA IYAFLNEEQT SNAA                                   154
//

If you have problems or comments...

PBIL Back to PBIL home page