(data stored in ACNUC7421 zone)

EMBL: CP001622.PE67

CP001622.PE67        Location/Qualifiers
FT   CDS             66479..66673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54379"
FT                   /db_xref="GOA:C6AZ53"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ53"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACS54379.1"
FT                   /translation="MPEPETLKRVASAFSVCASSLSATLAAVASSTIAAFCCAPWPICI
FT                   MAWLIFFKPTTMKSLSGTC"
     MPEPETLKRV ASAFSVCASS LSATLAAVAS STIAAFCCAP WPICIMAWLI FFKPTTMKSL        60
     SGTC                                                                     64
//

If you have problems or comments...

PBIL Back to PBIL home page