(data stored in ACNUC7421 zone)

EMBL: CP001622.PE68

CP001622.PE68        Location/Qualifiers
FT   CDS             complement(66833..67732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0069"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: ret:RHE_CH00409
FT                   ribose kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54380"
FT                   /db_xref="GOA:C6AZ54"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ54"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACS54380.1"
FT                   /translation="MITVFGSINMDLIATTERLPKPGETVAGNGFATAAGGKGANQALA
FT                   ARRAGRYVHMAGAVGKDAFAAEALALLDDAGTDLSLIKHVDGPTGTALILVGGDGENMI
FT                   AVVPGANGQVTPADAETAIGRMDEGDVLMLQLEVPAAAVEGALSAARAKGVTSILNLAP
FT                   LIPDAPRLGRLADIVIANETEFERLAGQEGMDAQAREAALVRLHAETGQTLIVTLGADG
FT                   VIAIRDGSISRAQGLKIQPVDTVGAGDTFCGYFAASLDDGLDFVSALRRAAVAGSLACL
FT                   KAGAQPSIPLSEEVADRI"
     MITVFGSINM DLIATTERLP KPGETVAGNG FATAAGGKGA NQALAARRAG RYVHMAGAVG        60
     KDAFAAEALA LLDDAGTDLS LIKHVDGPTG TALILVGGDG ENMIAVVPGA NGQVTPADAE       120
     TAIGRMDEGD VLMLQLEVPA AAVEGALSAA RAKGVTSILN LAPLIPDAPR LGRLADIVIA       180
     NETEFERLAG QEGMDAQARE AALVRLHAET GQTLIVTLGA DGVIAIRDGS ISRAQGLKIQ       240
     PVDTVGAGDT FCGYFAASLD DGLDFVSALR RAAVAGSLAC LKAGAQPSIP LSEEVADRI        299
//

If you have problems or comments...

PBIL Back to PBIL home page