(data stored in ACNUC7421 zone)

EMBL: CP001622.PE69

CP001622.PE69        Location/Qualifiers
FT   CDS             complement(67813..69036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0070"
FT                   /product="protein of unknown function DUF195"
FT                   /note="PFAM: protein of unknown function DUF195; KEGG:
FT                   rec:RHECIAT_CH0000452 putative DNA recombination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54381"
FT                   /db_xref="GOA:C6AZ55"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ55"
FT                   /inference="protein motif:PFAM:PF02646"
FT                   /protein_id="ACS54381.1"
FT                   /translation="MTVHSESLALSLASISPAMLALVGGGLAVLVLLVIVLLLRGSGLR
FT                   REQAEEANFRAEENEARMGELLKIQAEMQGRIAAMTEVFGARQSELNQTISQRLDGMSQ
FT                   RVSSTITEQTKSTHENLQRLQERLAVIDAAQNNIQTLAKDVVGLQAILSNKQTRGAFGQ
FT                   SRMETIVADGLPMGAYAFQQTLSNGSRPDCTIRMPNGAPPLVIDAKFPLEAWNAIRDAG
FT                   SPEAGKIAGQQFRRDMEVHIRDISEKYLIQGETQDTAFLFVPSESIFAEIHEHFEPVVQ
FT                   KAHRARIVIVSPSLLMLSIQVIQAVLKDQRMRAQAHLIQGEVAILMDDLSRLDERVRKL
FT                   QGHFAMAQKDIDMVVTSADKLTRRGARIEALEFEAGGDAKPARDSEAAAKSVESRTGLL
FT                   KLRVVDEE"
     MTVHSESLAL SLASISPAML ALVGGGLAVL VLLVIVLLLR GSGLRREQAE EANFRAEENE        60
     ARMGELLKIQ AEMQGRIAAM TEVFGARQSE LNQTISQRLD GMSQRVSSTI TEQTKSTHEN       120
     LQRLQERLAV IDAAQNNIQT LAKDVVGLQA ILSNKQTRGA FGQSRMETIV ADGLPMGAYA       180
     FQQTLSNGSR PDCTIRMPNG APPLVIDAKF PLEAWNAIRD AGSPEAGKIA GQQFRRDMEV       240
     HIRDISEKYL IQGETQDTAF LFVPSESIFA EIHEHFEPVV QKAHRARIVI VSPSLLMLSI       300
     QVIQAVLKDQ RMRAQAHLIQ GEVAILMDDL SRLDERVRKL QGHFAMAQKD IDMVVTSADK       360
     LTRRGARIEA LEFEAGGDAK PARDSEAAAK SVESRTGLLK LRVVDEE                     407
//

If you have problems or comments...

PBIL Back to PBIL home page