(data stored in ACNUC7421 zone)

EMBL: CP001622.PE7

CP001622.PE7         Location/Qualifiers
FT   CDS             6020..7108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0007"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /note="TIGRFAM: heat-inducible transcription repressor
FT                   HrcA; PFAM: Negative regulator of class I heat shock
FT                   protein; KEGG: ret:RHE_CH00364 heat-inducible transcription
FT                   repressor"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54319"
FT                   /db_xref="GOA:C6AY95"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY95"
FT                   /inference="protein motif:TFAM:TIGR00331"
FT                   /protein_id="ACS54319.1"
FT                   /translation="MGIRSTSVSDAVAALDERSREIFRRIVEGYLESGEPLGSRNLSRI
FT                   LPMSLSPASVRNVMSDLEELGLIYSPHVSAGRLPTQIGLRFFVDAFMQVGDLSAEERAS
FT                   IDRQVRAESGGNPVESMMNEASRMLSGISRGAGLVITSKSDPVLKHVEFIRLEPTKALA
FT                   VLVGDHDQVENRIIELPAGVTSSQLTEAANFLNAHMSGQTLPELRKQLSRLKDDVRHEL
FT                   DALSRDLVERGIAVWAGSPDEGKPTQLIIRGRANLLEGLAGAEDLDRLRLLFDDLEKKD
FT                   SLIEILNLAESGSGVRIFIGSENKLFSLSGSSLIVAPYRDDDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLVSRLSRNQL"
     MGIRSTSVSD AVAALDERSR EIFRRIVEGY LESGEPLGSR NLSRILPMSL SPASVRNVMS        60
     DLEELGLIYS PHVSAGRLPT QIGLRFFVDA FMQVGDLSAE ERASIDRQVR AESGGNPVES       120
     MMNEASRMLS GISRGAGLVI TSKSDPVLKH VEFIRLEPTK ALAVLVGDHD QVENRIIELP       180
     AGVTSSQLTE AANFLNAHMS GQTLPELRKQ LSRLKDDVRH ELDALSRDLV ERGIAVWAGS       240
     PDEGKPTQLI IRGRANLLEG LAGAEDLDRL RLLFDDLEKK DSLIEILNLA ESGSGVRIFI       300
     GSENKLFSLS GSSLIVAPYR DDDDRIVGAV GVIGPTRLNY SRIVPMVDYT AQLVSRLSRN       360
     QL                                                                      362
//

If you have problems or comments...

PBIL Back to PBIL home page