(data stored in ACNUC7421 zone)

EMBL: CP001622.PE70

CP001622.PE70        Location/Qualifiers
FT   CDS             69243..70727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0071"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: rec:RHECIAT_CH0000453
FT                   probable methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54382"
FT                   /db_xref="GOA:C6AZ56"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ56"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54382.1"
FT                   /translation="MTAQQTDNALRQRLDFIELDEAARKSMRDLRPVISELIGGALDKF
FT                   YAKIAKTPAVADKSQLGHAKKRQQDHWVNLTGGTFDESYVDGVTAVGRMHERMGLEPRW
FT                   SIGGYAIVMSELVKGIMEKQWPSIFARQQGKLLAEKLSAVVKSGMLDMDYSISVYLETL
FT                   EAKRRALEEQRAEAQSDQAIALEQLRRGLEALSNGDLEATLPSDLPGNFRQMAEDYNRA
FT                   VSALRQSFASVRETSGHIKTGADVISNATNDLALRTAQQAAGVEESSAALQQLSVSVGQ
FT                   TAANAEKASDAVRETQQKAKNSGELVTSAVSAMAGIEKSSTGISKIIGVIDEIAFQTNL
FT                   LALNAGVEAARAGDAGKGFAVVAQEVRQLAQRTVEAAKEIKNLISQSSTQVNQGVGIVS
FT                   STGEALNDMISRIDIINRFVADIAAAARDQATGVNEVSLAVRNMGAITQQNSDMVEHSS
FT                   AETRRLKDEVETLIELLQHFRARPEGRSAGAARRAA"
     MTAQQTDNAL RQRLDFIELD EAARKSMRDL RPVISELIGG ALDKFYAKIA KTPAVADKSQ        60
     LGHAKKRQQD HWVNLTGGTF DESYVDGVTA VGRMHERMGL EPRWSIGGYA IVMSELVKGI       120
     MEKQWPSIFA RQQGKLLAEK LSAVVKSGML DMDYSISVYL ETLEAKRRAL EEQRAEAQSD       180
     QAIALEQLRR GLEALSNGDL EATLPSDLPG NFRQMAEDYN RAVSALRQSF ASVRETSGHI       240
     KTGADVISNA TNDLALRTAQ QAAGVEESSA ALQQLSVSVG QTAANAEKAS DAVRETQQKA       300
     KNSGELVTSA VSAMAGIEKS STGISKIIGV IDEIAFQTNL LALNAGVEAA RAGDAGKGFA       360
     VVAQEVRQLA QRTVEAAKEI KNLISQSSTQ VNQGVGIVSS TGEALNDMIS RIDIINRFVA       420
     DIAAAARDQA TGVNEVSLAV RNMGAITQQN SDMVEHSSAE TRRLKDEVET LIELLQHFRA       480
     RPEGRSAGAA RRAA                                                         494
//

If you have problems or comments...

PBIL Back to PBIL home page