(data stored in ACNUC7421 zone)

EMBL: CP001622.PE71

CP001622.PE71        Location/Qualifiers
FT   CDS             70825..71340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0072"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: rec:RHECIAT_CH0000454 peptide deformylase
FT                   protein; TIGRFAM: peptide deformylase; PFAM:
FT                   formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54383"
FT                   /db_xref="GOA:C6AZ57"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ57"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACS54383.1"
FT                   /translation="MTIKPLIILPDPVLRQLSKPIERVDSDLQRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRMLVIDIAREGEEKQPQVFINPEVVKSSDERSVYEEGCLSIPDYYAEV
FT                   ERPAVVSVKYLDRNGKEQTVEADGLLATCLQHEIDHLNGVLFIDYISRLKREMVIKKFT
FT                   KAAKSKAL"
     MTIKPLIILP DPVLRQLSKP IERVDSDLQR LADDMLETMY DAPGIGLAAI QIGVPRRMLV        60
     IDIAREGEEK QPQVFINPEV VKSSDERSVY EEGCLSIPDY YAEVERPAVV SVKYLDRNGK       120
     EQTVEADGLL ATCLQHEIDH LNGVLFIDYI SRLKREMVIK KFTKAAKSKA L                171
//

If you have problems or comments...

PBIL Back to PBIL home page