(data stored in ACNUC7421 zone)

EMBL: CP001622.PE72

CP001622.PE72        Location/Qualifiers
FT   CDS             71406..71666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0073"
FT                   /product="putative plasmid stabilization protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000455 probable plasmid
FT                   stabilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54384"
FT                   /db_xref="GOA:C6AZ58"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ58"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000455"
FT                   /protein_id="ACS54384.1"
FT                   /translation="MGDLLIRDVPDAMKRQLQESAQRNGRSLSEEAIEIMRRQIAVERS
FT                   RDSAGQRLRSLMSEERLSEDEVEAIAASRHERDREPPRFDT"
     MGDLLIRDVP DAMKRQLQES AQRNGRSLSE EAIEIMRRQI AVERSRDSAG QRLRSLMSEE        60
     RLSEDEVEAI AASRHERDRE PPRFDT                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page