(data stored in ACNUC7421 zone)

EMBL: CP001622.PE73

CP001622.PE73        Location/Qualifiers
FT   CDS             71663..72082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0074"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   ret:RHE_CH00413 plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54385"
FT                   /db_xref="GOA:C6AZ59"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ59"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACS54385.1"
FT                   /translation="MIVLDTNVISEMQGRIHSDRILNWLDAYDVETLFLTTIAVAEMRY
FT                   GLELLDDGRRKTALVSDFNRIESEFAGRILGFALSAAHRYGLLAAERRKAGRPMETKDA
FT                   MIAAICLANGATLATRNTRDFEGLDLKLVNPFEDG"
     MIVLDTNVIS EMQGRIHSDR ILNWLDAYDV ETLFLTTIAV AEMRYGLELL DDGRRKTALV        60
     SDFNRIESEF AGRILGFALS AAHRYGLLAA ERRKAGRPME TKDAMIAAIC LANGATLATR       120
     NTRDFEGLDL KLVNPFEDG                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page