(data stored in ACNUC7421 zone)

EMBL: CP001622.PE74

CP001622.PE74        Location/Qualifiers
FT   CDS             72103..73038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0075"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="KEGG: ret:RHE_CH00414 methionyl-tRNA
FT                   formyltransferase; TIGRFAM: methionyl-tRNA
FT                   formyltransferase; PFAM: formyl transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54386"
FT                   /db_xref="GOA:C6AZ60"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ60"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACS54386.1"
FT                   /translation="MSLRIIFMGTPEFSVPTLRLLVDAGHRIVAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGLPVFTPVNFKDPEERERFRGLNADVGVVVAYGLLLPEAILNGTRD
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDAKTGMMVMKMDKGLDTGAVALTREVEIGPNMT
FT                   AGELHDRLMLVGAKAMAEAMVKLEMNDLPLTPQPEDGVLYAAKIDKAETRIDFSRNAGD
FT                   VHNHIRGLAPFPGAWFELEIGGKPERVKVLASELAEGQGAAGLLLTDDLVIACGSGALR
FT                   LTRLQKAGGKPLAAADFLRGTPLAAGTRLT"
     MSLRIIFMGT PEFSVPTLRL LVDAGHRIVA VYTQPPRPGG RRGLDLQKSP VHQAAELLGL        60
     PVFTPVNFKD PEERERFRGL NADVGVVVAY GLLLPEAILN GTRDGCYNGH ASLLPRWRGA       120
     APIQRAIMAG DAKTGMMVMK MDKGLDTGAV ALTREVEIGP NMTAGELHDR LMLVGAKAMA       180
     EAMVKLEMND LPLTPQPEDG VLYAAKIDKA ETRIDFSRNA GDVHNHIRGL APFPGAWFEL       240
     EIGGKPERVK VLASELAEGQ GAAGLLLTDD LVIACGSGAL RLTRLQKAGG KPLAAADFLR       300
     GTPLAAGTRL T                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page