(data stored in ACNUC7421 zone)

EMBL: CP001622.PE75

CP001622.PE75        Location/Qualifiers
FT   CDS             73038..73856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0076"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000458 tRNA-pseudouridine
FT                   synthase I protein; TIGRFAM: tRNA pseudouridine synthase A;
FT                   PFAM: tRNA pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54387"
FT                   /db_xref="GOA:C6AZ61"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ61"
FT                   /inference="protein motif:TFAM:TIGR00071"
FT                   /protein_id="ACS54387.1"
FT                   /translation="MPRFRMTVEYDGGPYVGWQRQENGHSVQGAIEAAVLSLTGETVLV
FT                   RGAGRTDSGVHAMGQVIHADLSKEWSPYQLQNALNAHLRLAGERVSILEVEAAPEFFDA
FT                   RFSALRRHYLYRIVSRRAPLALEAGKAWWVPKVLDHEVMHAAAQRLVGKHDFSTFRAAH
FT                   CQANSPVRTLDRLDVTRNGELIEIRATAQSFLHNQIRSFAGTLKLAGEGKWTPDDVEAA
FT                   LEARDRKACGPVAPPDGLYFMQVDYPDVIPDRRRPVTDTDANDGDADDPS"
     MPRFRMTVEY DGGPYVGWQR QENGHSVQGA IEAAVLSLTG ETVLVRGAGR TDSGVHAMGQ        60
     VIHADLSKEW SPYQLQNALN AHLRLAGERV SILEVEAAPE FFDARFSALR RHYLYRIVSR       120
     RAPLALEAGK AWWVPKVLDH EVMHAAAQRL VGKHDFSTFR AAHCQANSPV RTLDRLDVTR       180
     NGELIEIRAT AQSFLHNQIR SFAGTLKLAG EGKWTPDDVE AALEARDRKA CGPVAPPDGL       240
     YFMQVDYPDV IPDRRRPVTD TDANDGDADD PS                                     272
//

If you have problems or comments...

PBIL Back to PBIL home page