(data stored in ACNUC7421 zone)

EMBL: CP001622.PE76

CP001622.PE76        Location/Qualifiers
FT   CDS             complement(73863..74459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54388"
FT                   /db_xref="GOA:C6AZ62"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ62"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00416"
FT                   /protein_id="ACS54388.1"
FT                   /translation="MPGFREVQYYLAGLWLLIRLDPRGFRYLDMSERGVNRSFWAMLWC
FT                   LPPMGISWLWWRQAFLRSMPPEADVDFPFYIRLGLVEVANWFVPLVFAGVLLLAFRMGE
FT                   RFAPVVVSVNWLGVPLSYINGLLLALVFFLPGSIGLVSLLLLAFMLAQVFVLARIIRMI
FT                   CHGHALMTGALTLVLLVPSMILSEYLQHFLGIYPV"
     MPGFREVQYY LAGLWLLIRL DPRGFRYLDM SERGVNRSFW AMLWCLPPMG ISWLWWRQAF        60
     LRSMPPEADV DFPFYIRLGL VEVANWFVPL VFAGVLLLAF RMGERFAPVV VSVNWLGVPL       120
     SYINGLLLAL VFFLPGSIGL VSLLLLAFML AQVFVLARII RMICHGHALM TGALTLVLLV       180
     PSMILSEYLQ HFLGIYPV                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page