(data stored in ACNUC7421 zone)

EMBL: CP001622.PE77

CP001622.PE77        Location/Qualifiers
FT   CDS             complement(74446..75639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0078"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /note="TIGRFAM: succinyl-diaminopimelate desuccinylase;
FT                   PFAM: peptidase M20; peptidase dimerisation domain protein;
FT                   KEGG: ret:RHE_CH00417 succinyl-diaminopimelate
FT                   desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54389"
FT                   /db_xref="GOA:C6AZ63"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ63"
FT                   /inference="protein motif:TFAM:TIGR01246"
FT                   /protein_id="ACS54389.1"
FT                   /translation="MTATDPVANLQTLIRCPSVTPAEGGALTALEAMLAPLGFALDRVK
FT                   ASEEGTPEIENLYARLGKDGPHLMFAGHTDVVPVGDEAAWTHPPFEAQISKGELFGRGA
FT                   VDMKGGIACFVAAVARHIEKNGPPNGSISFLITGDEEGPAINGTIKLLQWAAERGERWD
FT                   ACLVGEPTNPDRLGDMIKIGRRGSLSGKITVHGVQGHAAYPHLADNPVRGMLQLTQALM
FT                   DPPFDAGTGDFQPSNLEVTTVDVGNPATNVIPAKASASFNIRFNDSWTVETLRAEILRR
FT                   LEAAAGNGALRPGRDPVAYDIVWADRPSHVFLTRNNALIASLSSAVESVAGQSPRLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAVADLETLTAIYETFIARWFANAGL"
     MTATDPVANL QTLIRCPSVT PAEGGALTAL EAMLAPLGFA LDRVKASEEG TPEIENLYAR        60
     LGKDGPHLMF AGHTDVVPVG DEAAWTHPPF EAQISKGELF GRGAVDMKGG IACFVAAVAR       120
     HIEKNGPPNG SISFLITGDE EGPAINGTIK LLQWAAERGE RWDACLVGEP TNPDRLGDMI       180
     KIGRRGSLSG KITVHGVQGH AAYPHLADNP VRGMLQLTQA LMDPPFDAGT GDFQPSNLEV       240
     TTVDVGNPAT NVIPAKASAS FNIRFNDSWT VETLRAEILR RLEAAAGNGA LRPGRDPVAY       300
     DIVWADRPSH VFLTRNNALI ASLSSAVESV AGQSPRLSTT GGTSDARFIK DYCPVVEFGL       360
     VGQTMHMVDE RVAVADLETL TAIYETFIAR WFANAGL                                397
//

If you have problems or comments...

PBIL Back to PBIL home page