(data stored in ACNUC7421 zone)

EMBL: CP001622.PE78

CP001622.PE78        Location/Qualifiers
FT   CDS             complement(75741..76601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0079"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="TIGRFAM:
FT                   2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase; KEGG: ret:RHE_CH00418
FT                   2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54390"
FT                   /db_xref="GOA:C6AZ64"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ64"
FT                   /inference="protein motif:TFAM:TIGR00965"
FT                   /protein_id="ACS54390.1"
FT                   /translation="MSATDLASLEKIIESAFDNRDNVNTSTKGEVRDAVEAALDLLDAG
FT                   KARVAERSADGAWTVNQWLKKAVLLSFRLNDMDVVEGGSGNSTWWDKVPSKFENWGENH
FT                   FRAAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKHV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIIREGSVLGMGVFIGKSTKIV
FT                   DRATGEVSYGEVPPYSVVVAGSMPSGNATMGNGQPAPHLYCAVIVKRVDEKTRSKTGIN
FT                   ELLRD"
     MSATDLASLE KIIESAFDNR DNVNTSTKGE VRDAVEAALD LLDAGKARVA ERSADGAWTV        60
     NQWLKKAVLL SFRLNDMDVV EGGSGNSTWW DKVPSKFENW GENHFRAAGF RAVPNCVVRR       120
     SAYIAPNAIL MPSFVNLGAY VGEGTMVDTW ATVGSCAQIG KHVHLSGGVG IGGVLEPMQA       180
     GPTIIEDNCF IGARSEVVEG CIIREGSVLG MGVFIGKSTK IVDRATGEVS YGEVPPYSVV       240
     VAGSMPSGNA TMGNGQPAPH LYCAVIVKRV DEKTRSKTGI NELLRD                      286
//

If you have problems or comments...

PBIL Back to PBIL home page