(data stored in ACNUC7421 zone)

EMBL: CP001622.PE79

CP001622.PE79        Location/Qualifiers
FT   CDS             76794..77660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rec:RHECIAT_CH0000462 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54391"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ65"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ACS54391.1"
FT                   /translation="MAKGRNGGSRRKDGVWDPLKSSSTDKQRAEAVPKTPQTMSPAYRL
FT                   AYVDQDFLCREELRPIRLQLELLKTEMMLTERGIKSTVVMFGGARIPAPGQSAWAARND
FT                   IQRVNLEAASVYYDEARKFARLCSKYSATFNFHEYVIVTGGGPGVMEAGNRGAADEGAP
FT                   SIGLNIVLPHEQAPNAYVTPELSFNFHYFAIRKMHFMVRAKAIAVFPGGFGTLDEFFEC
FT                   LTLIQTGRMERLPLILFGETFWRSIINFEALAEFGTIAPDDVKLISFVDTAEAAWKIVQ
FT                   DFYEHRE"
     MAKGRNGGSR RKDGVWDPLK SSSTDKQRAE AVPKTPQTMS PAYRLAYVDQ DFLCREELRP        60
     IRLQLELLKT EMMLTERGIK STVVMFGGAR IPAPGQSAWA ARNDIQRVNL EAASVYYDEA       120
     RKFARLCSKY SATFNFHEYV IVTGGGPGVM EAGNRGAADE GAPSIGLNIV LPHEQAPNAY       180
     VTPELSFNFH YFAIRKMHFM VRAKAIAVFP GGFGTLDEFF ECLTLIQTGR MERLPLILFG       240
     ETFWRSIINF EALAEFGTIA PDDVKLISFV DTAEAAWKIV QDFYEHRE                    288
//

If you have problems or comments...

PBIL Back to PBIL home page