(data stored in ACNUC7421 zone)

EMBL: CP001622.PE8

CP001622.PE8         Location/Qualifiers
FT   CDS             7220..7852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0008"
FT                   /product="GrpE protein"
FT                   /note="PFAM: GrpE protein; KEGG: rec:RHECIAT_CH0000404
FT                   molecular chaperone heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54320"
FT                   /db_xref="GOA:C6AY96"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY96"
FT                   /inference="protein motif:PFAM:PF01025"
FT                   /protein_id="ACS54320.1"
FT                   /translation="MTDDTTKNGPDATAADAAADATAYVENETAQEEAAQPDALELLKA
FT                   ENGELRDRYLRLAAEMDNLRRRTEREVKDAKSYSVAGFARDMLAVSDNLRRALDAIPPE
FT                   TRAAADAGLSTLIEGVEMTERAMLSALERHGVRKLEPVGQKFDPNFHQAMFEVPNPDVP
FT                   NNTVVQVVQAGFSIGERVLRPAMVGVAKGGPKPAEAETNSVFDEKDA"
     MTDDTTKNGP DATAADAAAD ATAYVENETA QEEAAQPDAL ELLKAENGEL RDRYLRLAAE        60
     MDNLRRRTER EVKDAKSYSV AGFARDMLAV SDNLRRALDA IPPETRAAAD AGLSTLIEGV       120
     EMTERAMLSA LERHGVRKLE PVGQKFDPNF HQAMFEVPNP DVPNNTVVQV VQAGFSIGER       180
     VLRPAMVGVA KGGPKPAEAE TNSVFDEKDA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page