(data stored in ACNUC7421 zone)

EMBL: CP001622.PE80

CP001622.PE80        Location/Qualifiers
FT   CDS             complement(77747..78385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0081"
FT                   /product="Calcium-binding EF-hand-containing protein"
FT                   /note="SMART: Calcium-binding EF-hand-containing protein;
FT                   KEGG: ret:RHE_CH00420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54392"
FT                   /db_xref="GOA:C6AZ66"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ66"
FT                   /inference="protein motif:SMART:SM00054"
FT                   /protein_id="ACS54392.1"
FT                   /translation="MYRNKLILAALSSTLIFGAAAGAGYAAPGDGPRQHPGRHGPMHGP
FT                   GPAAFREITYVRMLKQFDTNKDGQISKDEATAGIDKIFAAIDTNKDGSLTPGEIGAYQK
FT                   AQMQAMRDQRKQDASNNKDAKTADATPDNNDQGRPPQGGHEGRDGHRWMRHGGNIMRAS
FT                   IMMHRVDTDQNGRISKQEAEAGMDKLFTRMDRNKDGVISIDDMPDRPLL"
     MYRNKLILAA LSSTLIFGAA AGAGYAAPGD GPRQHPGRHG PMHGPGPAAF REITYVRMLK        60
     QFDTNKDGQI SKDEATAGID KIFAAIDTNK DGSLTPGEIG AYQKAQMQAM RDQRKQDASN       120
     NKDAKTADAT PDNNDQGRPP QGGHEGRDGH RWMRHGGNIM RASIMMHRVD TDQNGRISKQ       180
     EAEAGMDKLF TRMDRNKDGV ISIDDMPDRP LL                                     212
//

If you have problems or comments...

PBIL Back to PBIL home page