(data stored in ACNUC7421 zone)

EMBL: CP001622.PE81

CP001622.PE81        Location/Qualifiers
FT   CDS             complement(78490..79197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0082"
FT                   /product="pyrimidine 5'-nucleotidase"
FT                   /note="TIGRFAM: pyrimidine 5'-nucleotidase; HAD-superfamily
FT                   hydrolase, subfamily IA, variant 3; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG:
FT                   rec:RHECIAT_CH0000464 putative hydrolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54393"
FT                   /db_xref="GOA:C6AZ67"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ67"
FT                   /inference="protein motif:TFAM:TIGR01993"
FT                   /protein_id="ACS54393.1"
FT                   /translation="MTKIDRTPDKADFEHVTDWVFDLDNTLYPHHVNLFAQIDKNMTAY
FT                   VAALLQMEREEARKLQKQYYLEHGTTLQGLMIHHGIDPNDFLEKAHAIDYTALTPQPEL
FT                   GEAIKALPGRKFIFTNGSVKHAEMTAEALGILEHFDDIFDIVAADYVPKPAQATYDKFM
FT                   ALKRVETTKAAMFEDLPRNLTVPKALGMQTVLLVPRNLEETVVEWWEKTSGDEDHIDFV
FT                   TDDLAAFLGKITG"
     MTKIDRTPDK ADFEHVTDWV FDLDNTLYPH HVNLFAQIDK NMTAYVAALL QMEREEARKL        60
     QKQYYLEHGT TLQGLMIHHG IDPNDFLEKA HAIDYTALTP QPELGEAIKA LPGRKFIFTN       120
     GSVKHAEMTA EALGILEHFD DIFDIVAADY VPKPAQATYD KFMALKRVET TKAAMFEDLP       180
     RNLTVPKALG MQTVLLVPRN LEETVVEWWE KTSGDEDHID FVTDDLAAFL GKITG            235
//

If you have problems or comments...

PBIL Back to PBIL home page