(data stored in ACNUC7421 zone)

EMBL: CP001622.PE82

CP001622.PE82        Location/Qualifiers
FT   CDS             79300..80376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0083"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="KEGG: ret:RHE_CH00423
FT                   methylated-DNA-[protein]-cysteine S-methyltransferase
FT                   protein; TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Ada metal-binding domain protein;
FT                   Methylated-DNA-[protein]-cysteine S-methyltransferase DNA
FT                   binding; SMART: helix-turn-helix- domain containing protein
FT                   AraC type"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54394"
FT                   /db_xref="GOA:C6AZ68"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ68"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACS54394.1"
FT                   /translation="MLFERPNDDTLYDALIARSADYEGQAYVCVKTTGIFCRLTCPARK
FT                   PKRENTLFFDTIAACMHSGFRPCQRCRPLEQPGREPIVDELLAALDREPQLRWSEDELV
FT                   RRGHDPSTVRRAFKRGLGMTFHDIVRYRRLGEAARQLADGARVIDAQLEAGYDSPSGFR
FT                   TAFQRLVGKAPALSQNRELLFADWFETPLGPMVAVADRTHLHLLEFHDRKALPTELEAL
FT                   QKRVRSSVAIGRTPAIDQIEAEIRDYFEGRLTVFKTPLALGGTPFEKHVWAKLMDITAG
FT                   QTRAYGDLAREMERPEVVRAVGRANGANQLAIIVPCHRILGADGSLTGYGGGLWRKQWL
FT                   LRHEEKIRAQAPNVEETA"
     MLFERPNDDT LYDALIARSA DYEGQAYVCV KTTGIFCRLT CPARKPKREN TLFFDTIAAC        60
     MHSGFRPCQR CRPLEQPGRE PIVDELLAAL DREPQLRWSE DELVRRGHDP STVRRAFKRG       120
     LGMTFHDIVR YRRLGEAARQ LADGARVIDA QLEAGYDSPS GFRTAFQRLV GKAPALSQNR       180
     ELLFADWFET PLGPMVAVAD RTHLHLLEFH DRKALPTELE ALQKRVRSSV AIGRTPAIDQ       240
     IEAEIRDYFE GRLTVFKTPL ALGGTPFEKH VWAKLMDITA GQTRAYGDLA REMERPEVVR       300
     AVGRANGANQ LAIIVPCHRI LGADGSLTGY GGGLWRKQWL LRHEEKIRAQ APNVEETA         358
//

If you have problems or comments...

PBIL Back to PBIL home page