(data stored in ACNUC7421 zone)

EMBL: CP001622.PE83

CP001622.PE83        Location/Qualifiers
FT   CDS             80373..81143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0084"
FT                   /product="putative carboxyphosphonoenolpyruvate
FT                   phosphonomutase protein"
FT                   /note="KEGG: ret:RHE_CH00424 putative
FT                   carboxyphosphonoenolpyruvate phosphonomutase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54395"
FT                   /db_xref="GOA:C6AZ69"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ69"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00424"
FT                   /protein_id="ACS54395.1"
FT                   /translation="MNQSEKAKAFGALHRKGDPVVLYNIWDAGTAKAVTDAGAKALATG
FT                   SWSVAAAHGYADGEKLPMSVLVETAKSITAVVNLPLSVDFEGAYSAEPEGAAANVAKLV
FT                   EVGAIGINFEDQVVGGGGLYPAERQAARIRAIRAMAEGEGIPFFINARTDLFLAESDLS
FT                   KHAGLVEEAIERGKAYAAAGGSGFFVPGLIDPALIEKICAASPLPVNIMMRTGAPDVKT
FT                   LAKLGVGRISYGPGPYRSMMEKLKQEAAAIYSPL"
     MNQSEKAKAF GALHRKGDPV VLYNIWDAGT AKAVTDAGAK ALATGSWSVA AAHGYADGEK        60
     LPMSVLVETA KSITAVVNLP LSVDFEGAYS AEPEGAAANV AKLVEVGAIG INFEDQVVGG       120
     GGLYPAERQA ARIRAIRAMA EGEGIPFFIN ARTDLFLAES DLSKHAGLVE EAIERGKAYA       180
     AAGGSGFFVP GLIDPALIEK ICAASPLPVN IMMRTGAPDV KTLAKLGVGR ISYGPGPYRS       240
     MMEKLKQEAA AIYSPL                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page