(data stored in ACNUC7421 zone)

EMBL: CP001622.PE84

CP001622.PE84        Location/Qualifiers
FT   CDS             complement(81209..82357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0085"
FT                   /product="FMN-dependent alpha-hydroxy acid dehydrogenase"
FT                   /note="PFAM: FMN-dependent alpha-hydroxy acid
FT                   dehydrogenase; KEGG: ret:RHE_CH00425 L-lactate
FT                   dehydrogenase (cytochrome) protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54396"
FT                   /db_xref="GOA:C6AZ70"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ70"
FT                   /inference="protein motif:PFAM:PF01070"
FT                   /protein_id="ACS54396.1"
FT                   /translation="MRLTDCYNFHDFRRMAKRRLPGPIFDYIDGGADDEVTYRRNTAAF
FT                   EACDLVPDVLRGVADVDMSVTVMGQKLAMPVYCSPTALQRLFHHQGERAVAAAAAKHGT
FT                   MFGVSSLGTISLEEARQISNGPQVYQFYFHKDRGLNREMMARAKNAGVQAMMLTVDSIT
FT                   GGNRERDKRTGFAIPFKLNLAGMTQFAIKPSWAIDWLTHERFRLPQLENHVKMDGGALS
FT                   ISRYFTEMLDPSMSWDDVAEMVREWGGPFCLKGIMSVEDAKRAAEIGCSGIVLSNHGGR
FT                   QLDGSRSAFDQLAEIVDAVGDRVDVMMDGGVQRGTHVLKALSLGAKAVGLGRYYLFPLA
FT                   AAGQPGVERALETMRTEIERGMKLMGCTSVSQLSRRNLRFRS"
     MRLTDCYNFH DFRRMAKRRL PGPIFDYIDG GADDEVTYRR NTAAFEACDL VPDVLRGVAD        60
     VDMSVTVMGQ KLAMPVYCSP TALQRLFHHQ GERAVAAAAA KHGTMFGVSS LGTISLEEAR       120
     QISNGPQVYQ FYFHKDRGLN REMMARAKNA GVQAMMLTVD SITGGNRERD KRTGFAIPFK       180
     LNLAGMTQFA IKPSWAIDWL THERFRLPQL ENHVKMDGGA LSISRYFTEM LDPSMSWDDV       240
     AEMVREWGGP FCLKGIMSVE DAKRAAEIGC SGIVLSNHGG RQLDGSRSAF DQLAEIVDAV       300
     GDRVDVMMDG GVQRGTHVLK ALSLGAKAVG LGRYYLFPLA AAGQPGVERA LETMRTEIER       360
     GMKLMGCTSV SQLSRRNLRF RS                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page