(data stored in ACNUC7421 zone)

EMBL: CP001622.PE85

CP001622.PE85        Location/Qualifiers
FT   CDS             complement(82427..83314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0086"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: rec:RHECIAT_CH0000469 acetylglutamate kinase
FT                   protein; TIGRFAM: acetylglutamate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54397"
FT                   /db_xref="GOA:C6AZ71"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ71"
FT                   /inference="protein motif:TFAM:TIGR00761"
FT                   /protein_id="ACS54397.1"
FT                   /translation="MNETESEMQARLLAKALPFMQRYENKTIVVKYGGHAMGNPELGKA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLSKMGIESKFEGGLRVTDQKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTIKDPDSNIERVLDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGATYNINADTFAGAIAGALNATRLLFLTDVPGVL
FT                   DKNGQLIKELSVAEAHALIADGTISGGMIPKVETCIDAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTEHGVGTLIVP"
     MNETESEMQA RLLAKALPFM QRYENKTIVV KYGGHAMGNP ELGKAFASDI ALLKQSGVNP        60
     IVVHGGGPQI GAMLSKMGIE SKFEGGLRVT DQKTVEIVEM VLAGSINKEI VALINQTGEW       120
     AIGLCGKDGN MVFAEKARKT IKDPDSNIER VLDLGFVGEV VEVDRTLLDL LARSEMIPVI       180
     APVAPGRDGA TYNINADTFA GAIAGALNAT RLLFLTDVPG VLDKNGQLIK ELSVAEAHAL       240
     IADGTISGGM IPKVETCIDA IKAGVQGVVI LNGKTAHSVL LEIFTEHGVG TLIVP            295
//

If you have problems or comments...

PBIL Back to PBIL home page