(data stored in ACNUC7421 zone)

EMBL: CP001622.PE86

CP001622.PE86        Location/Qualifiers
FT   CDS             83458..83997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0087"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; sigma-70 region 4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000470 RNA polymerase sigma-70 factor
FT                   protein, ECF family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54398"
FT                   /db_xref="GOA:C6AZ72"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ72"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS54398.1"
FT                   /translation="MQGDDIADLIGRVALGDRRAFVALYNQTGPKLFSICLRILKDRTE
FT                   AEEALQEAYISIWQRARSFSVASGSSSAWLAAIARNRSIDALRARKPVADELDTVYDLA
FT                   DAGADPEMQTVTKDEGRRIDTCMEELEADRAVAVKRAYVEGLSYQELADQFGIPLNTMR
FT                   TWLRRSLLKLRECMER"
     MQGDDIADLI GRVALGDRRA FVALYNQTGP KLFSICLRIL KDRTEAEEAL QEAYISIWQR        60
     ARSFSVASGS SSAWLAAIAR NRSIDALRAR KPVADELDTV YDLADAGADP EMQTVTKDEG       120
     RRIDTCMEEL EADRAVAVKR AYVEGLSYQE LADQFGIPLN TMRTWLRRSL LKLRECMER        179
//

If you have problems or comments...

PBIL Back to PBIL home page