(data stored in ACNUC7421 zone)

EMBL: CP001622.PE87

CP001622.PE87        Location/Qualifiers
FT   CDS             83994..84713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000471 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54399"
FT                   /db_xref="GOA:C6AZ73"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ73"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000471"
FT                   /protein_id="ACS54399.1"
FT                   /translation="MTSPDKSKGDRSRDEVLAGEYVLGVLSLQDRRVVEERMRHDRPFA
FT                   AIVSRWETNLSAFNDEYEGVAPNRETFKQIEARLFGDGQKPPSFSQGLWNSAVFWRSLS
FT                   FACIVVAVSAVIFASGVVPEPQGPAPLVASLSGQNSTINLLASYELQSGRLKIVPVAAG
FT                   KPEEKSLELWLVPGSGMTRSLGVFQPGESGELVIPADLRSQVADGATLAVSLEPFGGSP
FT                   TGQATGPVIASGPLHRP"
     MTSPDKSKGD RSRDEVLAGE YVLGVLSLQD RRVVEERMRH DRPFAAIVSR WETNLSAFND        60
     EYEGVAPNRE TFKQIEARLF GDGQKPPSFS QGLWNSAVFW RSLSFACIVV AVSAVIFASG       120
     VVPEPQGPAP LVASLSGQNS TINLLASYEL QSGRLKIVPV AAGKPEEKSL ELWLVPGSGM       180
     TRSLGVFQPG ESGELVIPAD LRSQVADGAT LAVSLEPFGG SPTGQATGPV IASGPLHRP        239
//

If you have problems or comments...

PBIL Back to PBIL home page