(data stored in ACNUC7421 zone)

EMBL: CP001622.PE88

CP001622.PE88        Location/Qualifiers
FT   CDS             84836..85390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0089"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; SMART:
FT                   beta-Ig-H3/fasciclin; KEGG: rec:RHECIAT_CH0000472 putative
FT                   transforming growth factor-induced protein (and secreted
FT                   protein MPB70)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54400"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ74"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ACS54400.1"
FT                   /translation="MIKSVLRGVALATAMSAVAFAAAKNPVVGGAAMFDSKNIIENAVN
FT                   SKDHTTLVAAVKAAGLVGTLEGKGPFTVFAPTNEAFAALPKGTVDTLLKPENKATLTKV
FT                   LTCHVVAADAMAKTVAKMIKDDGGEHDIKTVGGCVLKAKENMGKITLTDENGGVSHVTI
FT                   ADVKQSNGVIHVVDKVLLPKM"
     MIKSVLRGVA LATAMSAVAF AAAKNPVVGG AAMFDSKNII ENAVNSKDHT TLVAAVKAAG        60
     LVGTLEGKGP FTVFAPTNEA FAALPKGTVD TLLKPENKAT LTKVLTCHVV AADAMAKTVA       120
     KMIKDDGGEH DIKTVGGCVL KAKENMGKIT LTDENGGVSH VTIADVKQSN GVIHVVDKVL       180
     LPKM                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page