(data stored in ACNUC7421 zone)

EMBL: CP001622.PE89

CP001622.PE89        Location/Qualifiers
FT   CDS             complement(85663..86739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0090"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: histidine kinase dimerisation/phosphoacceptor;
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; KEGG:
FT                   rec:RHECIAT_CH0000473 probable two-component sensor
FT                   histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54401"
FT                   /db_xref="GOA:C6AZ75"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ75"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACS54401.1"
FT                   /translation="MTDSKDQPISPEGVGNLPHLAEALDDDRFRHFLDHVPFAVAVSEL
FT                   GGNEPLIYVNLEFERLTALGATEVQGKPWPDIELNSTAVSGEVPLTAAVTSAEEYIGAF
FT                   SLVAEPESTVIIDVWSNTIVDDDDTPLFRLVAFAARSEATAAESFSELLTEKDVLLREL
FT                   QHRVKNNLQMITALIRMEARNAQQNEESERFARLAGRIEALALLYRSLSDEEKGATVDL
FT                   GTYVSQIAASVMAAHAVEGIRLDMKVDTWPVSVDVAMPAGLVINELLTNTLKHAFVGRD
FT                   GGEITLRCVVSETGCRITVADNGVGLPQDVTWPQPGKLSAMIVQSLKQNARAEVEVSSS
FT                   PDTGMSVSLVFPRAEAAQ"
     MTDSKDQPIS PEGVGNLPHL AEALDDDRFR HFLDHVPFAV AVSELGGNEP LIYVNLEFER        60
     LTALGATEVQ GKPWPDIELN STAVSGEVPL TAAVTSAEEY IGAFSLVAEP ESTVIIDVWS       120
     NTIVDDDDTP LFRLVAFAAR SEATAAESFS ELLTEKDVLL RELQHRVKNN LQMITALIRM       180
     EARNAQQNEE SERFARLAGR IEALALLYRS LSDEEKGATV DLGTYVSQIA ASVMAAHAVE       240
     GIRLDMKVDT WPVSVDVAMP AGLVINELLT NTLKHAFVGR DGGEITLRCV VSETGCRITV       300
     ADNGVGLPQD VTWPQPGKLS AMIVQSLKQN ARAEVEVSSS PDTGMSVSLV FPRAEAAQ         358
//

If you have problems or comments...

PBIL Back to PBIL home page