(data stored in ACNUC7421 zone)

EMBL: CP001622.PE9

CP001622.PE9         Location/Qualifiers
FT   CDS             complement(7917..8861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0009"
FT                   /product="Inosine/uridine-preferring nucleoside hydrolase"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: rec:RHECIAT_CH0000405
FT                   inosine-adenosine-guanosine preferring nucleoside hydrolase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54321"
FT                   /db_xref="GOA:C6AY97"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY97"
FT                   /inference="protein motif:PFAM:PF01156"
FT                   /protein_id="ACS54321.1"
FT                   /translation="MASARKIIIDTDPGQDDAAAIMLAFGSPDELEVLGITTVAGNVPL
FT                   SLTSRNARIVCELCERTETKVFAGADAPIARKLVTAEHVHGKTGLDGPELNEPTMALQP
FT                   GHAVDFIIETLRHEPEGTVTLCTLGPLTNIGMAFQKAPDIIPRIRELVMMGGGFFEGGN
FT                   ITPAAEFNIYVDPEAADIVFRSGVPIVMMPLDVTHQLLTRKDRVKRMAEIGTAPAKAMV
FT                   EMLEFFERFDIEKYGSDGGPLHDPTVVAYLLKPELFQGRDCNVEIEVQSELTVGMTVVD
FT                   WWHVTERKRNAKVMRHVDADGFFDLLIERFARI"
     MASARKIIID TDPGQDDAAA IMLAFGSPDE LEVLGITTVA GNVPLSLTSR NARIVCELCE        60
     RTETKVFAGA DAPIARKLVT AEHVHGKTGL DGPELNEPTM ALQPGHAVDF IIETLRHEPE       120
     GTVTLCTLGP LTNIGMAFQK APDIIPRIRE LVMMGGGFFE GGNITPAAEF NIYVDPEAAD       180
     IVFRSGVPIV MMPLDVTHQL LTRKDRVKRM AEIGTAPAKA MVEMLEFFER FDIEKYGSDG       240
     GPLHDPTVVA YLLKPELFQG RDCNVEIEVQ SELTVGMTVV DWWHVTERKR NAKVMRHVDA       300
     DGFFDLLIER FARI                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page