(data stored in ACNUC7421 zone)

EMBL: CP001622.PE90

CP001622.PE90        Location/Qualifiers
FT   CDS             complement(86861..87136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0091"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00433 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54402"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ76"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00433"
FT                   /protein_id="ACS54402.1"
FT                   /translation="MAETPQELQSINTAWQIAIQEILRMVIRDMYHGGGEASFKTHIKR
FT                   IEEAAVDSIYTDLRLRGTDEWTEVLVKERASNFVTTLLTSFTYDRA"
     MAETPQELQS INTAWQIAIQ EILRMVIRDM YHGGGEASFK THIKRIEEAA VDSIYTDLRL        60
     RGTDEWTEVL VKERASNFVT TLLTSFTYDR A                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page