(data stored in ACNUC7421 zone)

EMBL: CP001622.PE91

CP001622.PE91        Location/Qualifiers
FT   CDS             complement(87257..87481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54403"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ77"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00434"
FT                   /protein_id="ACS54403.1"
FT                   /translation="MTETYSKSRQRAEIAFGNVQTQFFAKNQAAEELESDAQSQQAKTL
FT                   RLREARLAREQSDRVSATSALIAKRARAR"
     MTETYSKSRQ RAEIAFGNVQ TQFFAKNQAA EELESDAQSQ QAKTLRLREA RLAREQSDRV        60
     SATSALIAKR ARAR                                                          74
//

If you have problems or comments...

PBIL Back to PBIL home page