(data stored in ACNUC7421 zone)

EMBL: CP001622.PE93

CP001622.PE93        Location/Qualifiers
FT   CDS             complement(88092..88745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0094"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   ret:RHE_CH00436 GTPase EngB"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54405"
FT                   /db_xref="GOA:C6AZ79"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ79"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACS54405.1"
FT                   /translation="MPETEKPLFGHPWIFIRGVPSLNFLPPEGPLEVAFAGRSNVGKSS
FT                   LINALVGQKGLARTSNTPGRTQELNYFVPDGYSGEGQDLPPTAIVDMPGYGYAQAPKEQ
FT                   VDKWTKLVFDYLRGRATLKRVYVLIDSRHGIKKNDDDVLDLLDKAAVSYQIVLTKTDKI
FT                   KAAGVPKLLAETAEKIRKRPAAYPGVLSTSSEKGDGLDELRQAIAETVGIARWK"
     MPETEKPLFG HPWIFIRGVP SLNFLPPEGP LEVAFAGRSN VGKSSLINAL VGQKGLARTS        60
     NTPGRTQELN YFVPDGYSGE GQDLPPTAIV DMPGYGYAQA PKEQVDKWTK LVFDYLRGRA       120
     TLKRVYVLID SRHGIKKNDD DVLDLLDKAA VSYQIVLTKT DKIKAAGVPK LLAETAEKIR       180
     KRPAAYPGVL STSSEKGDGL DELRQAIAET VGIARWK                                217
//

If you have problems or comments...

PBIL Back to PBIL home page