(data stored in ACNUC7421 zone)

EMBL: CP001622.PE94

CP001622.PE94        Location/Qualifiers
FT   CDS             complement(88899..90692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0095"
FT                   /product="60 kDa inner membrane insertion protein"
FT                   /note="PFAM: 60 kDa inner membrane insertion protein; KEGG:
FT                   rec:RHECIAT_CH0000478 inner membrane transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54406"
FT                   /db_xref="GOA:C6AZ80"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ80"
FT                   /inference="protein motif:PFAM:PF02096"
FT                   /protein_id="ACS54406.1"
FT                   /translation="MENNRNYFIAIALSVLIVLGWQFLYMNPRIEAQRKVQEAQKAQQQ
FT                   TEQVQQPAAGGQTPAQPSGAAPTSQAAATATLEQALAKSPRVVIDTAALSGSINLAGAR
FT                   LDDLKLKGYHETVDDSSPIITLFSPAETKDGYFTELGYIGSDATGSVPGPSTLWTAPEG
FT                   AKLTEKTPVTLSYTNDKGLTFTRTISVDERYMFTVADKIENAGQAPASLNSYGRVTRYN
FT                   KPTTPSVYVLHEGFIGVIGDDGLVETKYTAAEKEAVKPAKSTGGWLGITDKYWAATIVP
FT                   PQSAPYEASFSHFADGQPRYQADYKEDAFTVAPGQSIELKNLVFAGAKEVPVIDGYEAS
FT                   YSIPKFDRLIDWGWFYFITKPMFKLMDFFFRYFGNFGVAILCTTIVVKLLFFPLASKQY
FT                   ASMANMKRMQPKMEELKAKFADDRMGLQQATMQLYKEEKINPIAGCWPVALQIPIFFSL
FT                   YKVIYITIEMRHAPFFGWIKDLSAPDPTTIVNLFGLLPFEAPTILHLGVWPLIMGVTMF
FT                   LQMRMNPTPPDPTQAMIFTWMPLVFMFMLASFPAGLVIYWAWNNTLSVAQQSVIMKRHG
FT                   VKVELFDNLKGLFRRKTAPSK"
     MENNRNYFIA IALSVLIVLG WQFLYMNPRI EAQRKVQEAQ KAQQQTEQVQ QPAAGGQTPA        60
     QPSGAAPTSQ AAATATLEQA LAKSPRVVID TAALSGSINL AGARLDDLKL KGYHETVDDS       120
     SPIITLFSPA ETKDGYFTEL GYIGSDATGS VPGPSTLWTA PEGAKLTEKT PVTLSYTNDK       180
     GLTFTRTISV DERYMFTVAD KIENAGQAPA SLNSYGRVTR YNKPTTPSVY VLHEGFIGVI       240
     GDDGLVETKY TAAEKEAVKP AKSTGGWLGI TDKYWAATIV PPQSAPYEAS FSHFADGQPR       300
     YQADYKEDAF TVAPGQSIEL KNLVFAGAKE VPVIDGYEAS YSIPKFDRLI DWGWFYFITK       360
     PMFKLMDFFF RYFGNFGVAI LCTTIVVKLL FFPLASKQYA SMANMKRMQP KMEELKAKFA       420
     DDRMGLQQAT MQLYKEEKIN PIAGCWPVAL QIPIFFSLYK VIYITIEMRH APFFGWIKDL       480
     SAPDPTTIVN LFGLLPFEAP TILHLGVWPL IMGVTMFLQM RMNPTPPDPT QAMIFTWMPL       540
     VFMFMLASFP AGLVIYWAWN NTLSVAQQSV IMKRHGVKVE LFDNLKGLFR RKTAPSK          597
//

If you have problems or comments...

PBIL Back to PBIL home page