(data stored in ACNUC7421 zone)

EMBL: CP001622.PE95

CP001622.PE95        Location/Qualifiers
FT   CDS             complement(90692..91093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0096"
FT                   /product="ribonuclease P protein component"
FT                   /note="TIGRFAM: ribonuclease P protein component; PFAM:
FT                   ribonuclease P protein; KEGG: rec:RHECIAT_CH0000479
FT                   ribonuclease P protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54407"
FT                   /db_xref="GOA:C6AZ81"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ81"
FT                   /inference="protein motif:TFAM:TIGR00188"
FT                   /protein_id="ACS54407.1"
FT                   /translation="MAGELTISEKKHTVGRLKSRPQFLAAREGEKRRGGLFLLEVLDRK
FT                   EPDSQARVGFTVTKKHGNAVERNRMRRRLKEAVRLHAGFAMQPGHDYVVVARRDVLDAS
FT                   FQELAAELKSRVETRPKHRRSGDGRPRNV"
     MAGELTISEK KHTVGRLKSR PQFLAAREGE KRRGGLFLLE VLDRKEPDSQ ARVGFTVTKK        60
     HGNAVERNRM RRRLKEAVRL HAGFAMQPGH DYVVVARRDV LDASFQELAA ELKSRVETRP       120
     KHRRSGDGRP RNV                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page