(data stored in ACNUC7421 zone)

EMBL: CP001622.PE97

CP001622.PE97        Location/Qualifiers
FT   CDS             91668..93665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0098"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: rec:RHECIAT_CH0000481 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54409"
FT                   /db_xref="GOA:C6AZ83"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ83"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54409.1"
FT                   /translation="MKIRGKINLLVCVMGAVALLIGATALSAMHEYSRNLTAYEHAAAR
FT                   AYAGERLNRFVTAVVMEARGIYAAKTIKDTPNFAKGLMADLDEIDKVISGWAPLVPESQ
FT                   KADFAKLVARAAEFRTFRTETVRLGTEVGPEAAGQQGNNDANRANRKAFQAEIDAVVAT
FT                   DKAALETVNAEIESFRSWVLMLVLSITGIGIAVGVGMGFYIGTSHLSRPIKRVTHAIKE
FT                   VADGNFDAEVPFAGRPDEIGEMAAAVAVFKANGLAIKRLNAQEAAMRAKSDDLQSSMSV
FT                   VVAAAAAGDFGHRISKDYEDDNLNQFAGNINMLLSSVDAGIGETRRVIASLAEGDLTQT
FT                   MSGNFQGAFAELQQNVNNTFVTLQATMREVRETTEAMNGNTAELRNASDDLSKRTEQQA
FT                   AALEETSAALDEITAVVQNSTERAHEATIMVSEAKENAGRSGVVVRNAVEAMGRIEQAS
FT                   REISQIINVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRSATAAKDI
FT                   KALITKSGNEVQVGVKLVQATGEALAEIGTRVIAINDHIHSIATAATEQSTGLKEVNTA
FT                   VNQMDQVTQQNAAMVEETSAATHRLSAEAGGLVRLIARFKLSDDAPAPAALVRNEPHRP
FT                   VASPARRAIAKVARAFGGNAAAAEQSWEEF"
     MKIRGKINLL VCVMGAVALL IGATALSAMH EYSRNLTAYE HAAARAYAGE RLNRFVTAVV        60
     MEARGIYAAK TIKDTPNFAK GLMADLDEID KVISGWAPLV PESQKADFAK LVARAAEFRT       120
     FRTETVRLGT EVGPEAAGQQ GNNDANRANR KAFQAEIDAV VATDKAALET VNAEIESFRS       180
     WVLMLVLSIT GIGIAVGVGM GFYIGTSHLS RPIKRVTHAI KEVADGNFDA EVPFAGRPDE       240
     IGEMAAAVAV FKANGLAIKR LNAQEAAMRA KSDDLQSSMS VVVAAAAAGD FGHRISKDYE       300
     DDNLNQFAGN INMLLSSVDA GIGETRRVIA SLAEGDLTQT MSGNFQGAFA ELQQNVNNTF       360
     VTLQATMREV RETTEAMNGN TAELRNASDD LSKRTEQQAA ALEETSAALD EITAVVQNST       420
     ERAHEATIMV SEAKENAGRS GVVVRNAVEA MGRIEQASRE ISQIINVIDE IAFQTNLLAL       480
     NAGVEAARAG DAGKGFAVVA QEVRELAQRS ATAAKDIKAL ITKSGNEVQV GVKLVQATGE       540
     ALAEIGTRVI AINDHIHSIA TAATEQSTGL KEVNTAVNQM DQVTQQNAAM VEETSAATHR       600
     LSAEAGGLVR LIARFKLSDD APAPAALVRN EPHRPVASPA RRAIAKVARA FGGNAAAAEQ       660
     SWEEF                                                                   665
//

If you have problems or comments...

PBIL Back to PBIL home page