(data stored in ACNUC7421 zone)

EMBL: CP001622.PE98

CP001622.PE98        Location/Qualifiers
FT   CDS             93823..95343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0099"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; KEGG: rec:RHECIAT_CH0000482
FT                   two-component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54410"
FT                   /db_xref="GOA:C6AZ84"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ84"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACS54410.1"
FT                   /translation="MPIQDQGDNPSAESPAAGEAARAPCPSAGLFGGLSGKLLWLTVFF
FT                   IMLAEILIFFPSVASMRVRWLQDRLNTAAAAAIVIDGLQPVELPRALQKETLEATGTKA
FT                   IVLRKDGTSRLLATTDMPTSVDEAYDLTDVPPVTAIRDALDTLVFGGGRMIRVYGPVGD
FT                   TNTGVEVVMKDRPLRRAMFVYSRNVLLLSVLISLFTATLIFFAINRILIGPIRRLTGSM
FT                   QQFSSDPDNPAHIYIGDGGRDELAVAGRNLTSMQMELQKTLKQQKNLAALGLAVSKINH
FT                   DMRNILASAQLMSDRLVDVDDPMVKSFAPKLLRTIDRAVGYTTEVLSYGKASESAPRRR
FT                   HIRLLELTQDVKDMLAIDPQSGIEFAEQIGAELEVDADGEQLFRVIHNLCRNALQALTS
FT                   PGEGGPGSVRRITVSAQRVGSVVSITVDDTGPGMPLKARQNLFAAFRGSARSGGTGLGL
FT                   TIARELVLAHGGTIALVEKPTVGTQFRIEIPDRPVSLEDYRSRAHIEK"
     MPIQDQGDNP SAESPAAGEA ARAPCPSAGL FGGLSGKLLW LTVFFIMLAE ILIFFPSVAS        60
     MRVRWLQDRL NTAAAAAIVI DGLQPVELPR ALQKETLEAT GTKAIVLRKD GTSRLLATTD       120
     MPTSVDEAYD LTDVPPVTAI RDALDTLVFG GGRMIRVYGP VGDTNTGVEV VMKDRPLRRA       180
     MFVYSRNVLL LSVLISLFTA TLIFFAINRI LIGPIRRLTG SMQQFSSDPD NPAHIYIGDG       240
     GRDELAVAGR NLTSMQMELQ KTLKQQKNLA ALGLAVSKIN HDMRNILASA QLMSDRLVDV       300
     DDPMVKSFAP KLLRTIDRAV GYTTEVLSYG KASESAPRRR HIRLLELTQD VKDMLAIDPQ       360
     SGIEFAEQIG AELEVDADGE QLFRVIHNLC RNALQALTSP GEGGPGSVRR ITVSAQRVGS       420
     VVSITVDDTG PGMPLKARQN LFAAFRGSAR SGGTGLGLTI ARELVLAHGG TIALVEKPTV       480
     GTQFRIEIPD RPVSLEDYRS RAHIEK                                            506
//

If you have problems or comments...

PBIL Back to PBIL home page