(data stored in ACNUC7421 zone)

EMBL: CP001622.PE99

CP001622.PE99        Location/Qualifiers
FT   CDS             96024..97955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0100"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54411"
FT                   /db_xref="GOA:C6AZ85"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C6AZ85"
FT                   /inference="similar to AA sequence:KEGG:Arad_4537"
FT                   /protein_id="ACS54411.1"
FT                   /translation="MAFVLNTFGRLQLVDGEGSLVAFPEKGLLLLVYLLTTGEGSADRT
FT                   TLARFLWGDADRDVALSTLRKLISRVKARQAELGINILSSQGNMVSLDRKSLSSDLLLS
FT                   ETDEAVASFSLLKHLVKLLNQPFLGPVHCHSREFQQWLAEREKCHIDLLANTLKTVSRR
FT                   AQSRAESELLRKAAIILFRTEPKDPDTLQLLIEIFKAEEEVESLRTYFEQRRNSISRGI
FT                   AVRGASDGADTKPVRPALVPSREKHVTAASLEPEDVSIAIPRLVLLPPRNQSIHPQAGF
FT                   LAASLVEDITIGFCAFNSLQVIAPYSAVQIGHHMETQKAFFERHHVNYILDTRISNAGD
FT                   DVTLFAQLIFFDQNQIVWAERFSLDHRDLVKDRRTVSRRIALSISSEIERHEALREDLN
FT                   PAAYHRYLVGRRHLARLTLPNLRRARKEMKAALSLSPDFAPALSSMARTYSKEWLLTAR
FT                   GDIDLLKTAEILAKQATETRPDFADGYREFGVAKLLQGAFDESAEAMEVAESLAPHYAD
FT                   VIADYADTLVHCSLPAIALRKIERAIELNPLSPDTYFWTAAGANYALGEFEASLDYIGQ
FT                   MADASLADRLAAASWAMLGHQDKARIFVRRFREVNPDFDVDKWLSAVPSKEQWHKDLYR
FT                   EGLKKAGF"
     MAFVLNTFGR LQLVDGEGSL VAFPEKGLLL LVYLLTTGEG SADRTTLARF LWGDADRDVA        60
     LSTLRKLISR VKARQAELGI NILSSQGNMV SLDRKSLSSD LLLSETDEAV ASFSLLKHLV       120
     KLLNQPFLGP VHCHSREFQQ WLAEREKCHI DLLANTLKTV SRRAQSRAES ELLRKAAIIL       180
     FRTEPKDPDT LQLLIEIFKA EEEVESLRTY FEQRRNSISR GIAVRGASDG ADTKPVRPAL       240
     VPSREKHVTA ASLEPEDVSI AIPRLVLLPP RNQSIHPQAG FLAASLVEDI TIGFCAFNSL       300
     QVIAPYSAVQ IGHHMETQKA FFERHHVNYI LDTRISNAGD DVTLFAQLIF FDQNQIVWAE       360
     RFSLDHRDLV KDRRTVSRRI ALSISSEIER HEALREDLNP AAYHRYLVGR RHLARLTLPN       420
     LRRARKEMKA ALSLSPDFAP ALSSMARTYS KEWLLTARGD IDLLKTAEIL AKQATETRPD       480
     FADGYREFGV AKLLQGAFDE SAEAMEVAES LAPHYADVIA DYADTLVHCS LPAIALRKIE       540
     RAIELNPLSP DTYFWTAAGA NYALGEFEAS LDYIGQMADA SLADRLAAAS WAMLGHQDKA       600
     RIFVRRFREV NPDFDVDKWL SAVPSKEQWH KDLYREGLKK AGF                         643
//

If you have problems or comments...

PBIL Back to PBIL home page