(data stored in ACNUC7421 zone)

EMBL: CP001630.PE1

CP001630.PE1         Location/Qualifiers
FT   CDS             98..1831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: bha:BH0001 chromosomal replication initiation
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33975"
FT                   /db_xref="GOA:C6WCF4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCF4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACU33975.1"
FT                   /translation="MSDHQADLGLVWEQVVEELANSALSSSTLSPQQRAWMRVTRPIGL
FT                   LDGTALLAAPSDFAKEAIERALREPITAALSRRLGRAVSLAVKVDSPEPPMASGPPTTP
FT                   IPVPMPPVPPSVAHGITFGQQVLGPVGPNGQTSLPIGGQADGPAGPPPPAPTGLPLEQP
FT                   ANAQAPAESPESDAEPEEGDEERETLATVNEIWPKFSRGAGGQPTPPSGTPFTRPANPA
FT                   SSQTRLNEKYNFDTFVIGASNRFAHAAAVAVAEAPARAYNPLFIWGESGLGKTHLLHAV
FT                   GHYAQRLFPGMRVRYVSTEEFTNDFINSLRDDRKVAFQRRYRDIDVLLVDDIQFLEGKE
FT                   GTQEEFFHTFNTLHNSNKQIVVSSDRPPKRLETLEDRLRTRFEWGLITDIQPPELETRI
FT                   AILRKKAAQDRLAAPAEVLEFIAARVVRNIRELEGALIRVTAFASLNRQPVDVQLAEIV
FT                   LRDLIPDSHVPEITAPTIMAVTAEFFEVTIEDLCGPGKTKVLSTARQISMYLCRELTDL
FT                   SLPKIGQTFGGRDHTTVMYADKKIRKEMAERRRIYDQVQELTSRIKQRSRYLVAPPVDP
FT                   T"
     MSDHQADLGL VWEQVVEELA NSALSSSTLS PQQRAWMRVT RPIGLLDGTA LLAAPSDFAK        60
     EAIERALREP ITAALSRRLG RAVSLAVKVD SPEPPMASGP PTTPIPVPMP PVPPSVAHGI       120
     TFGQQVLGPV GPNGQTSLPI GGQADGPAGP PPPAPTGLPL EQPANAQAPA ESPESDAEPE       180
     EGDEERETLA TVNEIWPKFS RGAGGQPTPP SGTPFTRPAN PASSQTRLNE KYNFDTFVIG       240
     ASNRFAHAAA VAVAEAPARA YNPLFIWGES GLGKTHLLHA VGHYAQRLFP GMRVRYVSTE       300
     EFTNDFINSL RDDRKVAFQR RYRDIDVLLV DDIQFLEGKE GTQEEFFHTF NTLHNSNKQI       360
     VVSSDRPPKR LETLEDRLRT RFEWGLITDI QPPELETRIA ILRKKAAQDR LAAPAEVLEF       420
     IAARVVRNIR ELEGALIRVT AFASLNRQPV DVQLAEIVLR DLIPDSHVPE ITAPTIMAVT       480
     AEFFEVTIED LCGPGKTKVL STARQISMYL CRELTDLSLP KIGQTFGGRD HTTVMYADKK       540
     IRKEMAERRR IYDQVQELTS RIKQRSRYLV APPVDPT                                577
//

If you have problems or comments...

PBIL Back to PBIL home page