(data stored in ACNUC7421 zone)

EMBL: CP001630.PE10

CP001630.PE10        Location/Qualifiers
FT   CDS             complement(12873..13304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0010"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: gur:Gura_3338 DoxX
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACU33984"
FT                   /db_xref="GOA:C6WCG3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C6WCG3"
FT                   /inference="protein motif:PFAM:PF07681"
FT                   /protein_id="ACU33984.1"
FT                   /translation="MSLLDRGREQILSIFRIVIAFFMICHGAQKVFGVLGGKGGFSPLN
FT                   WPSGPAGLIEVVGGALVLIGLWTRVASIIVSGAMAYAYFVVHQPMGLLPIENKGELAAV
FT                   YSWAFLLLAFTGPGVWAVDTILASRKKNAENRELANAAA"
     MSLLDRGREQ ILSIFRIVIA FFMICHGAQK VFGVLGGKGG FSPLNWPSGP AGLIEVVGGA        60
     LVLIGLWTRV ASIIVSGAMA YAYFVVHQPM GLLPIENKGE LAAVYSWAFL LLAFTGPGVW       120
     AVDTILASRK KNAENRELAN AAA                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page