(data stored in ACNUC7421 zone)

EMBL: CP001630.PE100

CP001630.PE100       Location/Qualifiers
FT   CDS             109492..110394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0100"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: ank:AnaeK_2061 prephenate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34074"
FT                   /db_xref="GOA:C6WDS9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDS9"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACU34074.1"
FT                   /translation="MVAPVPRIAYFGPRGTFTEQAARGFGSDLEPRETIPAALEAARTG
FT                   EAELACVPVENSVEGAVPATMDALAEGAPLIAVAETVLAVRFSLLVRPGGGPVRTVASH
FT                   PHALAQVRHWLAANLPDAVAVAATSTAAAAVAVQRGEHDAAVTAPVAAEHYPLEVAATD
FT                   LADVRDAKTRFLLLRGPGALPEPTGSDRTSVVVTAPDRVGVLSDVLVEFALRGVNLTRI
FT                   ESRPTKGPLGEYRFYIDFDGHVAEPRVGDALAALRRHCPDTRFLGSYPKAVREDVVAEN
FT                   ADFVAAAEWVVAIREGRGA"
     MVAPVPRIAY FGPRGTFTEQ AARGFGSDLE PRETIPAALE AARTGEAELA CVPVENSVEG        60
     AVPATMDALA EGAPLIAVAE TVLAVRFSLL VRPGGGPVRT VASHPHALAQ VRHWLAANLP       120
     DAVAVAATST AAAAVAVQRG EHDAAVTAPV AAEHYPLEVA ATDLADVRDA KTRFLLLRGP       180
     GALPEPTGSD RTSVVVTAPD RVGVLSDVLV EFALRGVNLT RIESRPTKGP LGEYRFYIDF       240
     DGHVAEPRVG DALAALRRHC PDTRFLGSYP KAVREDVVAE NADFVAAAEW VVAIREGRGA       300
//

If you have problems or comments...

PBIL Back to PBIL home page