(data stored in ACNUC7421 zone)

EMBL: CP001630.PE101

CP001630.PE101       Location/Qualifiers
FT   CDS             110391..111002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0101"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: lch:Lcho_3955
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34075"
FT                   /db_xref="GOA:C6WDT0"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT0"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACU34075.1"
FT                   /translation="MRLLLVRHGETASNVAMALDSLPPGPPLTEAGRAQAEALARDLAD
FT                   VPVTAVHASVAVRAQQTAAPVAAAHGLEVRVVDGVQEIFCGELEGRSDREAYGTFMRTV
FT                   RSWAEGDLDVPLPGGESGRQVLDRYLAAVEEVTAGRAEDDVVVLVSHGASLRMAALALA
FT                   TNVTPALMAAGLLPNTGRVELERVGDGWVCTSWTGVDVAG"
     MRLLLVRHGE TASNVAMALD SLPPGPPLTE AGRAQAEALA RDLADVPVTA VHASVAVRAQ        60
     QTAAPVAAAH GLEVRVVDGV QEIFCGELEG RSDREAYGTF MRTVRSWAEG DLDVPLPGGE       120
     SGRQVLDRYL AAVEEVTAGR AEDDVVVLVS HGASLRMAAL ALATNVTPAL MAAGLLPNTG       180
     RVELERVGDG WVCTSWTGVD VAG                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page