(data stored in ACNUC7421 zone)

EMBL: CP001630.PE102

CP001630.PE102       Location/Qualifiers
FT   CDS             complement(111845..112261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0104"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34076"
FT                   /db_xref="InterPro:IPR025680"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34076.1"
FT                   /translation="MVTRLRISHQRGKPILAASVAELDAAIDLISGDSARQECPSMVEI
FT                   TIEEDPYGHAYIDAGIGVEQGFVHLNGPDTYRTTVGDPNAAGTVLYDCCGNGEDVPARE
FT                   EVPLATVHAVLAAFLAHDGLIPDDHPDLHLSPTG"
     MVTRLRISHQ RGKPILAASV AELDAAIDLI SGDSARQECP SMVEITIEED PYGHAYIDAG        60
     IGVEQGFVHL NGPDTYRTTV GDPNAAGTVL YDCCGNGEDV PAREEVPLAT VHAVLAAFLA       120
     HDGLIPDDHP DLHLSPTG                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page