(data stored in ACNUC7421 zone)

EMBL: CP001630.PE103

CP001630.PE103       Location/Qualifiers
FT   CDS             complement(112255..112677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34077"
FT                   /db_xref="InterPro:IPR032724"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACU34077.1"
FT                   /translation="MDGPHGTPVLDRIAKLREELPPPAVPGKGQKTDGRWFDGNGAVRD
FT                   SVSGKDVDSEEAWRLLRESGIPLPRPPVVAHAEMKVAAAMRRLNVRHAVLVITNVPCDE
FT                   RWSCENLLPAVLPVGCSLSVHGPGYQRTFHGRTPKW"
     MDGPHGTPVL DRIAKLREEL PPPAVPGKGQ KTDGRWFDGN GAVRDSVSGK DVDSEEAWRL        60
     LRESGIPLPR PPVVAHAEMK VAAAMRRLNV RHAVLVITNV PCDERWSCEN LLPAVLPVGC       120
     SLSVHGPGYQ RTFHGRTPKW                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page