(data stored in ACNUC7421 zone)

EMBL: CP001630.PE105

CP001630.PE105       Location/Qualifiers
FT   CDS             113121..114014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0107"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34079"
FT                   /db_xref="GOA:C6WDT4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT4"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACU34079.1"
FT                   /translation="MIECPIELRPMANTQTRRRRKLGLYLQELRKKAGRTPDDVADLLG
FT                   ISRPTVNRTESGHTRCRRAELQAVLGYYGASEDERAKAVQLWEDAKDDATKIRFPARSS
FT                   SAFRNFLQAEAEATAVDSLEPHLVFGQLQTADYARALQHPAASPYLEEAVEAEEYVKAR
FT                   LERQRLLGGDNPIRVRAFMDESVLSREIGGVPVLLGQLRHLLELGERDNIAIHVVPLSV
FT                   GAYGAMSGGVTVLDFGDPEDPPVVFLDHAGGGAWVEDEEAVGRYVHMMNELESVALSES
FT                   ATAELIRTKIEVLERR"
     MIECPIELRP MANTQTRRRR KLGLYLQELR KKAGRTPDDV ADLLGISRPT VNRTESGHTR        60
     CRRAELQAVL GYYGASEDER AKAVQLWEDA KDDATKIRFP ARSSSAFRNF LQAEAEATAV       120
     DSLEPHLVFG QLQTADYARA LQHPAASPYL EEAVEAEEYV KARLERQRLL GGDNPIRVRA       180
     FMDESVLSRE IGGVPVLLGQ LRHLLELGER DNIAIHVVPL SVGAYGAMSG GVTVLDFGDP       240
     EDPPVVFLDH AGGGAWVEDE EAVGRYVHMM NELESVALSE SATAELIRTK IEVLERR          297
//

If you have problems or comments...

PBIL Back to PBIL home page