(data stored in ACNUC7421 zone)

EMBL: CP001630.PE107

CP001630.PE107       Location/Qualifiers
FT   CDS             complement(114247..114795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0109"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: ade:Adeh_1652 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34081"
FT                   /db_xref="GOA:C6WDT6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT6"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACU34081.1"
FT                   /translation="MTESNNVITGRDVFATLHTSAGDVRIKLFPQHAPQTVANFVELAE
FT                   GRREYTDPRTGERTTAPLYDGTVFHRVISGFMIQGGDPLGTGTGGPGYTFGDEFHPDLS
FT                   FTKPYLLAMANAGPGTNGSQFFVTVNATSWLNFKHTIFGEVADSASRGVVDRISLTETG
FT                   PQDRPVDDVVIEKVTIERD"
     MTESNNVITG RDVFATLHTS AGDVRIKLFP QHAPQTVANF VELAEGRREY TDPRTGERTT        60
     APLYDGTVFH RVISGFMIQG GDPLGTGTGG PGYTFGDEFH PDLSFTKPYL LAMANAGPGT       120
     NGSQFFVTVN ATSWLNFKHT IFGEVADSAS RGVVDRISLT ETGPQDRPVD DVVIEKVTIE       180
     RD                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page