(data stored in ACNUC7421 zone)

EMBL: CP001630.PE108

CP001630.PE108       Location/Qualifiers
FT   CDS             115026..118412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0110"
FT                   /product="glycoside hydrolase family 31"
FT                   /note="PFAM: glycoside hydrolase family 31; Carbohydrate
FT                   binding family 6; Ricin B lectin; SMART: cellulose binding
FT                   type IV; Ricin B lectin; KEGG: aba:Acid345_1956 glycoside
FT                   hydrolase, family 31"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34082"
FT                   /db_xref="GOA:C6WDT7"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR000772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR033403"
FT                   /db_xref="InterPro:IPR035992"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT7"
FT                   /inference="protein motif:PFAM:PF01055"
FT                   /protein_id="ACU34082.1"
FT                   /translation="MPRPLLAALLALGTALAGTAALDPPTAEAATGTVVDGNARFQVLS
FT                   PTLIRLEHAGDGAFTDATTFNALNRDFPTPQYTTTVSGEYREIRTSALTLRYKRGSGPF
FT                   TAANTTVQTSAGTGAPAFPSHCAFGTACEAENGLFGGTASAAYDHVGHSGSGFLAGFTG
FT                   AGASLTHRVSGIPGAGTYDLSVRYANAVGGDGQQVTRTLATSVDGTPGPTITLPVTGSW
FT                   DTWSTASVRITVGAGSRTLRLAQEGGATGNVNLDTVALTPVGATHPAADTTLLTTAYGA
FT                   GPKSTLGGWARSLDNPRTVPVALNPGVLNRGGWYLLDDTRTPLSTGPRPSHGDQPYQDG
FT                   YLFGYGKDHKRALGDLNALTGDSALLPRSAYGVWYSRYHAYSDADYRNTLLPAFRANFA
FT                   PIDWLVVDTDWKSPAKWDGWNWDRTLFPDPDGFLTWTEQQGLDVSLNVHPAIESDDPAF
FT                   AEANRVAGGLDHEGGTRYTWDWSDPAHLRSYFGLHEPFERQGVRAWWLDYCTGCGAARA
FT                   SDQAVAADNLINQAYAKDAEERGLRGFAFSRIGGAEQGGIQSNYALGPWSERRNTMHFT
FT                   GDTPGTWELLAFAARFTPDAAAAGLSNTSHDIGSFHGKHLADDLYARWVQLGAFQPIDR
FT                   LHSDHGDRLPWDYTGAAAEAGLKFLRLREALVPHTYSLARQAAKTGVPITRPMYLNYPD
FT                   HEDAYNHPAQYLFGDDVLVAPITTPNSASGTGSVNAWIPPGTWTDYFTGARHTGPAKVT
FT                   LTAPTTEMPVLVRSGGILTTRTDYVHNQGESPLTRLTLTIGSGGDGSTSLYEDEGEGLG
FT                   HRSGASATTALSWRDATRTLTVGARSGNHPGAVGSRSYTLRLAGTTAPTAVVVDGVRLP
FT                   ETAWSYNTNTRTTTVTTPALTTTSAHTVALSGSAAGNPTTGRVTGPDGRCLSAQPAGLA
FT                   ACDGSAAQQVSAPTGGTVRALGRCLGPAGTFVACDGSTGQTWVLRTTGELANRATGTCL
FT                   DATGARLSACSGVAWRFPPGALTGPGARCADVANADPASGTAVQLWECNGSDAQRWHAP
FT                   ADRTVRALGKCLDVRHGATADGTQVQLWDCNGTGSQLWETQADGTLRNPVSGRCLDGSD
FT                   QAQLRIRTCAGTAAQQFRLDA"
     MPRPLLAALL ALGTALAGTA ALDPPTAEAA TGTVVDGNAR FQVLSPTLIR LEHAGDGAFT        60
     DATTFNALNR DFPTPQYTTT VSGEYREIRT SALTLRYKRG SGPFTAANTT VQTSAGTGAP       120
     AFPSHCAFGT ACEAENGLFG GTASAAYDHV GHSGSGFLAG FTGAGASLTH RVSGIPGAGT       180
     YDLSVRYANA VGGDGQQVTR TLATSVDGTP GPTITLPVTG SWDTWSTASV RITVGAGSRT       240
     LRLAQEGGAT GNVNLDTVAL TPVGATHPAA DTTLLTTAYG AGPKSTLGGW ARSLDNPRTV       300
     PVALNPGVLN RGGWYLLDDT RTPLSTGPRP SHGDQPYQDG YLFGYGKDHK RALGDLNALT       360
     GDSALLPRSA YGVWYSRYHA YSDADYRNTL LPAFRANFAP IDWLVVDTDW KSPAKWDGWN       420
     WDRTLFPDPD GFLTWTEQQG LDVSLNVHPA IESDDPAFAE ANRVAGGLDH EGGTRYTWDW       480
     SDPAHLRSYF GLHEPFERQG VRAWWLDYCT GCGAARASDQ AVAADNLINQ AYAKDAEERG       540
     LRGFAFSRIG GAEQGGIQSN YALGPWSERR NTMHFTGDTP GTWELLAFAA RFTPDAAAAG       600
     LSNTSHDIGS FHGKHLADDL YARWVQLGAF QPIDRLHSDH GDRLPWDYTG AAAEAGLKFL       660
     RLREALVPHT YSLARQAAKT GVPITRPMYL NYPDHEDAYN HPAQYLFGDD VLVAPITTPN       720
     SASGTGSVNA WIPPGTWTDY FTGARHTGPA KVTLTAPTTE MPVLVRSGGI LTTRTDYVHN       780
     QGESPLTRLT LTIGSGGDGS TSLYEDEGEG LGHRSGASAT TALSWRDATR TLTVGARSGN       840
     HPGAVGSRSY TLRLAGTTAP TAVVVDGVRL PETAWSYNTN TRTTTVTTPA LTTTSAHTVA       900
     LSGSAAGNPT TGRVTGPDGR CLSAQPAGLA ACDGSAAQQV SAPTGGTVRA LGRCLGPAGT       960
     FVACDGSTGQ TWVLRTTGEL ANRATGTCLD ATGARLSACS GVAWRFPPGA LTGPGARCAD      1020
     VANADPASGT AVQLWECNGS DAQRWHAPAD RTVRALGKCL DVRHGATADG TQVQLWDCNG      1080
     TGSQLWETQA DGTLRNPVSG RCLDGSDQAQ LRIRTCAGTA AQQFRLDA                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page