(data stored in ACNUC7421 zone)

EMBL: CP001630.PE109

CP001630.PE109       Location/Qualifiers
FT   CDS             complement(120442..120792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Amir_0112"
FT                   /product="protein of unknown function DUF1025"
FT                   /note="PFAM: protein of unknown function DUF1025; KEGG:
FT                   eli:ELI_09390 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Amir_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACU34083"
FT                   /db_xref="InterPro:IPR010428"
FT                   /db_xref="InterPro:IPR038555"
FT                   /db_xref="UniProtKB/TrEMBL:C6WDT8"
FT                   /inference="protein motif:PFAM:PF06262"
FT                   /protein_id="ACU34083.1"
FT                   /translation="MPVEMTRQRFEELVAEALDEIPPEFASAMDNVVVLVEDRNPDEPT
FT                   LLGLYHGVALTERTSEYGGVLPDRITIYREALLDVCEDEDHVVEEVAVTVVHEIAHHFG
FT                   IDDATLHELGWG"
     MPVEMTRQRF EELVAEALDE IPPEFASAMD NVVVLVEDRN PDEPTLLGLY HGVALTERTS        60
     EYGGVLPDRI TIYREALLDV CEDEDHVVEE VAVTVVHEIA HHFGIDDATL HELGWG           116
//

If you have problems or comments...

PBIL Back to PBIL home page